Dime y lo olvido, enséñame y lo recuerdo, involúcrame y lo aprendo (B. F)

Proteínas, Umpa Lumpa de los seres vivos

Las proteínas, los Umpa Lumpa de los seres vivos.

Si hay una molécula protagonista en la biología del siglo XX esta es sin duda el ADN. Sin embargo yo les tengo más cariño a las proteínas, más numerosas y variadas (no en vano me paso todo el día trabajando con ellas).

Para mi son como los Umpa Lumpa (o Oompa Loompa), los pequeños duendes que hacen funcionar la fábrica de chocolate de Willy Wonka.

Las proteínas, los Umpa Lumpa de los seres vivos

Estructura 3D de la haditoxina, una de las proteínas
que forma parte del veneno de la cobra real.
Más información en Protein Data Bank

Bonita y compleja a la vez ¿no crees? Puedes seguir el trazado de la cadena principal recorriendo la cinta coloreada (desde el extremo izquierdo al derecho siguiendo el rojo, pasando por el naranja, amarillo, verde, azul celeste y finalizando en la flecha añil).

A pesar del cariño que las tengo no son muy conocidas entre los niños, ya que no las estudian hasta que llegan a bachillerato y sólo si eligen la modalidad de ciencias.

Pues sinceramente, esto me entristece un poco. Así que me he decidido a remediarlo y voy a contarles hoy algo sobre ellas.

Los Umpa Lumpa son todos muy parecidos pero en realidad son diferentes ¿verdad?. Pues las proteínas son justo al revés: parecen muy diferentes pero en realidad son similares.

Las proteínas se parecen porque son todas como cadenas construidas con eslabones de 20 tipos. El número total de eslabones que componen una proteína es muy variable: desde unos pocos hasta miles de ellos, pero únicamente de 20 tipos distintos.

A estas cadenas las llamamos secuencias, y cuando trabajamos con ellas en el ordenador las escribimos como si fueran una palabra, utilizando 20 letras mayúsculas distintas (una por cada tipo de eslabón o aminoácido).

Por ejemplo, la haditoxina es una proteína con 65 eslabones. Se trata de una toxina de la cobra real (Ophiophagus hannah).

Esta proteína es responsable, junto con otras sustancias del veneno de la cobra, del bloqueo muscular que experimentan sus presas al ser mordidas por esta. Su secuencia es como sigue:

TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIRGCTFTCPELTPNGKYVYCCRRDKCNQ

Sencillo ¿verdad? Un eslabón (o aminoácido) detrás de otro.

A su vez las proteínas son diferentes porque, aunque podamos pensar en ellas como cadenas de aminoácidos, en realidad estos se organizan en el espacio. ¡Las proteínas son siempre 3D!. Por eso la mayor parte de ellas tiene una forma característica.

En la jerga científica decimos que las proteínas se pliegan. Retomando el ejemplo, conocemos la estructura 3D de la haditoxina de la cobra real y podemos representarla en el ordenador que nos la muestra así.

¿Quieres ver qué formas tan distintas pueden llegar a tener las proteínas? En esta última imagen aparecen sólo algunas de las que conocemos su estructura 3D.

Como hay proteínas con estructuras muy diferentes pueden hacer todo tipo de funciones en los seres vivos (igual que los Umpa Lumpa en la fábrica de chocolate).

 ¡No vayas a creer que todas las proteínas son veneno! Pero ésta es otra historia y te la contaré en otro momento.

Origen y manera correcta de la utilización de los cubiertos de mesa ...

 ... Origen y manera correcta de la utilización de los cubiertos de mesa. Desde el principio de la historia, la forma de demostrar amistad ha sido ...


Origen del indoeuropeo en Turquía | VCN

 ... Un nuevo estudio sitúa el origen del indoeuropeo en lo que hoy es Anatolia en lugar de en Ucrania. Moeder, mat , mother y madre ,significan ...


El origen del pollo en Sudamérica | VCN

 ... El origen del pollo en Sudamérica. Esta cuestión puede parecer anodina, pero tiene su importancia si deseamos conocer mejor la historia de ...

Publicado por :http://www.laruedadelosinventos.org/
Creative Commons. Gracias por visitarnos y compartir en su red social favorita.